PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang10g01650.1
Common NameLR48_Vigan11g079500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family CO-like
Protein Properties Length: 372aa    MW: 41751.5 Da    PI: 5.5312
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang10g01650.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box248.2e-081861340
        zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                    +r C+ + + ++++fC  ++ +lC+ C +  H+       H++v
  Vang10g01650.1 18 ARACDSCISRRARWFCAADNAFLCHGCDTLVHSAnqlasrHERV 61
                    578*****************************657788888876 PP

2CCT66.85.9e-23316358143
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkq 43 
                     Rea+++RY+eKr+tR+F KkirYe+RK +Ae+RpR+KGrFvk+
  Vang10g01650.1 316 REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKR 358
                     9****************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.1E-81663IPR000315B-box-type zinc finger
PROSITE profilePS5011910.3521663IPR000315B-box-type zinc finger
PfamPF006434.2E-61861IPR000315B-box-type zinc finger
CDDcd000212.33E-81963No hitNo description
PROSITE profilePS5101715.993316358IPR010402CCT domain
PfamPF062038.1E-18316358IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
LSTMRDMKDA GALGAKTARA CDSCISRRAR WFCAADNAFL CHGCDTLVHS ANQLASRHER  60
VRLQTASSKV TTTTTHAWHS GFTRKARTPR HNNNKHFALQ QRLKEEVLFN NSSVLPLVPE  120
LGREEQEPVV VDNDETEEQM LCRVPVFDNY DVRTDDLDSF SDMDFAEFAA DVENLLDKED  180
DEISERVGGG VQGAMAKVKD EEDVDGDVAC YLESVFDMTN DDAFHWNSIE SVLSDTREKE  240
CVVASDGAVG EEGGTKRDIF LRLNYDEVIT AWSSQGSSPW TTSNPPKFNS GYDFCLGLSG  300
VDGDVRALRG DLDGGREARV SRYREKRRTR LFAKKIRYEV RKLNAEKRPR MKGRFVKRTC  360
FVGANAFPAY Q*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1326342RRTRLFAKKIRYEVRKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014505914.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 16
SwissprotQ8RWD01e-84COL16_ARATH; Zinc finger protein CONSTANS-LIKE 16
TrEMBLA0A0L9VSA70.0A0A0L9VSA7_PHAAN; Uncharacterized protein
TrEMBLA0A0S3QWV00.0A0A0S3QWV0_PHAAN; Uncharacterized protein
STRINGGLYMA05G35151.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14733392
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.14e-82B-box type zinc finger protein with CCT domain
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]